PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr030767.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 373aa    MW: 43092 Da    PI: 6.8843
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr030767.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.38.6e-5581381129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrF+Ptdeelv++yL+kk++ k++++ +vi++vd+yk+ePwdL+   k+ + +++ewyfFs++dkky+tg+r+nratk+g+Wkatg+dk++++ 
  Pbr030767.1   8 VPPGFRFRPTDEELVDYYLRKKIALKPIDF-DVIRDVDLYKIEPWDLEDlcKIGSgDQNEWYFFSHKDKKYPTGSRTNRATKAGFWKATGRDKAIYRG 104
                  69****************************.9***************943466553556**************************************9 PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                  ++ lvg++ktLvfykgrap+g+k+dW+mheyrle
  Pbr030767.1 105 EKFLVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 138
                  9999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-605158IPR003441NAC domain
PROSITE profilePS5100559.2438158IPR003441NAC domain
PfamPF023654.0E-289137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MNTLSSHVPP GFRFRPTDEE LVDYYLRKKI ALKPIDFDVI RDVDLYKIEP WDLEDLCKIG  60
SGDQNEWYFF SHKDKKYPTG SRTNRATKAG FWKATGRDKA IYRGEKFLVG MRKTLVFYKG  120
RAPNGQKSDW IMHEYRLETN ENGTPQAKGW VVCRVFKKKL AAVSRMGDYE SPDCYDQVSF  180
LPQLDNPPRT SMSRTYASQN EQQLHYSQCK QEFDLLYNMP HHHHDSFLQL PQLESPKVPH  240
QSATPYGNCV MQSSTLTQEE QFAQYISQQN LFKSSSSPSV HALDNNNDYL QAVDQVKDWR  300
ALDKYVASQL SHDQQDASKE VTNYSHAEEI FHVAEHINML ANDASRRPDN NNNIGQDYAS  360
TSTSTFQIDL WK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-47816217169NO APICAL MERISTEM PROTEIN
1ut4_B5e-47816217169NO APICAL MERISTEM PROTEIN
1ut7_A5e-47816217169NO APICAL MERISTEM PROTEIN
1ut7_B5e-47816217169NO APICAL MERISTEM PROTEIN
4dul_A5e-47816217169NAC domain-containing protein 19
4dul_B5e-47816217169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009339711.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_009339710.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_009339709.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-129NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM5WRV60.0M5WRV6_PRUPE; Uncharacterized protein
STRINGVIT_02s0154g00020.t011e-164(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-130NAC 007